Satisfaction Guaranteed
All products are handled with strict quality standards to ensure consistent research-grade excellence.
Secure Ordering
Our checkout is SSL encrypted and completely secure.
Third-party Tested
Our products are verified by independent third party laboratories to meet quality standards.
Batch & Lot Tracking
All product batches and lots are assigned unique identifiers and tied to publicly posted lab reports.
Endless Commitment
We are committed to helping our customers. If you have any questions or concerns, please reach out through our Contact Us page.
IGF-1 LR3
$99.99
Discount per Quantity
| Quantity | Discount | Price |
|---|---|---|
| 5 - 10 | 5% | $94.99 |
| 11 - 20 | 10% | $89.99 |
| 21+ | 15% | $84.99 |
Rigorous Third-Party Testing
Every batch of our research chemicals and peptides undergoes third-party testing.
Disclaimer: This product is intended solely for laboratory research purposes. It is not suitable for consumption by humans, nor for medical, veterinary, or household purposes. Kindly review our Terms & Conditions before making a purchase.
Always quality-tested, verified with third party COA’s
At every step, we prioritize quality by conducting rigorous third-party testing on all our products. These tests focus on five key characteristics- identity, purity, sterility, and endotoxin levels, and heavy metal content-ensuring that each product meets the highest standards of quality with independent third-party Certificates of Analysis (COAS) to verify our commitment to excellence.
Identity Test
Purity Test
Sterility Test
Endotoxin Test
Heavy Metals Test
Identity Test
Purity Test
Sterility Test
Endotoxin Test
Heavy Metals Test
*Disclaimer: This product is intended solely for laboratory research purposes. It is not suitable for consumption by humans, nor for medical, veterinary, or household purposes.Kindly review our Terms & Conditions before making a purchase.
IGF-1 LR3 Peptide Characteristics
| Property | Description |
| Name | IGF-1 LR3 (recombinant IGF-1 analogue; Arg3 substitution, N-terminal 13-aa extension) |
| Sequence | MFPAMPLLSLFVNPSRGVDEPSFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA |
| Molecular Weight | 9,117.5 g/mol |
| Molecular Formula | C400H625N111O116S9 |
| PubChem CID | n/a (CAS: 946870-92-4) |
| Product Form | Lyophilized powder supplied in 1 mg research vials |
| Purity | Typically ≥99%, verified via lot-specific Certificate of Analysis (COA) |
| Solubility | Soluble in sterile water or dilute acetic acid; gentle mixing |
| Storage | Lyophilized 2-8°C, or at/below -18°C extended; reconstituted 2-8°C |
COA and Quality Assurance
Spark Peptide provides a lot-specific Certificate of Analysis for every IGF-1 LR3 lot. Each COA documents identity by HPLC and/or mass spectrometry, purity, and, where applicable, sterility and endotoxin levels, plus lot-specific storage guidance. Testing is conducted by independent third-party laboratories including Janoshik. COAs are lot-traceable and available on the Lab Tests page.Handling and Storage
Store unopened IGF-1 LR3 vials at 36-46°F (2-8°C) for routine laboratory storage or at 0°F (-18°C) or below for longer-term preservation. Keep vials tightly sealed and protected from light, heat, and moisture until needed for research. When preparing a working solution, use an appropriate sterile reconstitution solution or compatible laboratory buffer in accordance with validated laboratory procedures. Prepared solutions may be maintained under refrigerated or frozen conditions as required by the research protocol, with aliquoting commonly used to help preserve sample integrity by minimizing repeated freeze-thaw cycles. Always follow institutional biosafety, laboratory handling, and disposal requirements.Legal and Regulatory Disclaimer
IGF-1 LR3 is supplied strictly for laboratory research use only. It is not approved for human or veterinary use, clinical administration, therapeutic applications, or diagnostic procedures of any kind. Its safety, efficacy, and appropriate handling in humans or animals have not been established. Purchasers are responsible for compliance with all applicable local, state, and federal laws and institutional biosafety regulations.Dr. Sony Sherpa, MBBS, MD
Medical author
Dr. Sony Sherpa holds a medical degree (MBBS, MD) and writes on peptide characterisation, chemical and structural data, and laboratory handling and storage. Her focus is on accuracy and fidelity to current published research, with all content presented for laboratory research use only. Read full profile



